SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002287 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002287
Domain Number 1 Region: 13-154
Classification Level Classification E-value
Superfamily ARM repeat 0.0000314
Family Armadillo repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002287   Gene: ENSLAFG00000002732   Transcript: ENSLAFT00000002731
Sequence length 204
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_69:5791324:6082601:1 gene:ENSLAFG00000002732 transcript:ENSLAFT00000002731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLCFQVEIEKLDYHHYLPLFFDGLCEMAFPYEFFARQGIHDMLEHGGNKILPVIPQLII
PIKNALNLRNRQVICVTLKVLQHLVVSADMVGEALVPYYRQILPILNIFKNMNGEFSRDA
GCLPSLLYQLISGHKVASDPPTQPYLFKFKFLNSGDGIDYSQQKRENIGDLIQETLEAFE
RYGGEDAFINIKYMVPTYESCLLN
Download sequence
Identical sequences G3SR22
ENSLAFP00000002287 ENSLAFP00000002287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]