SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002483 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002483
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-54
Family Necap1 N-terminal domain-like 0.000000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002483   Gene: ENSLAFG00000002979   Transcript: ENSLAFT00000002978
Sequence length 275
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:53199520:53210509:-1 gene:ENSLAFG00000002979 transcript:ENSLAFT00000002978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKL
EDKVSGELFAQAPVEQYPGIAVETVADSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFN
VSLQDHFKWQREACSNSRLSEAMDTRPKLDLGFKEGQTIKLSIGNITTKKGGASKPRTAG
PGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVVTP
APAPVSASNDLWGDFSTASSSVSNQAPQPSSWVQF
Download sequence
Identical sequences G3SRH4
ENSLAFP00000002483 ENSLAFP00000002483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]