SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002557 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002557
Domain Number 1 Region: 262-374
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.1e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00047
Further Details:      
 
Domain Number 2 Region: 1-59,202-247
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000244
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000431
Family Ankyrin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002557   Gene: ENSLAFG00000003064   Transcript: ENSLAFT00000003066
Sequence length 442
Comment pep:novel supercontig:loxAfr3:scaffold_55:3112581:3364727:-1 gene:ENSLAFG00000003064 transcript:ENSLAFT00000003066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRP
PRATSACAPISSPKTNGLAKDMSSLHISPNSGHVTSASGPQMASGVSLVSFNSRPDGMHQ
RSYSVSSADQWSEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHR
RKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILAS
LQSCESSKNKSRLTSQSEAMALQSIRNIRGNSHCVDCETQNPNWASLNLGALMCIECSGI
HRNLGTHLSRVRSLDLDDWPIELIKVMSSIGNELANSVWEESSQGRTKPSLDSTSEEKER
WIRAKYEQKLFLAPLPCLELSLGQHLLRATADEDLRTVILLLAHGSRDEVNETCGEGDGR
TALHLACRKGNVVLVQLLIWVG
Download sequence
Identical sequences G3SRM9
ENSLAFP00000002557 ENSLAFP00000002557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]