SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002744 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002744
Domain Number 1 Region: 514-560
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000458
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 2 Region: 93-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 33-81
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000641
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000002744
Domain Number - Region: 469-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0016
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002744   Gene: ENSLAFG00000003299   Transcript: ENSLAFT00000003300
Sequence length 560
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_17:39093729:39156786:1 gene:ENSLAFG00000003299 transcript:ENSLAFT00000003300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGERLHSLESNAINESLAKSRQARSVDVTPMPIDCELSSWSSWTTCDPCQKKRYRHASLL
RPSQFHGEPCSFSDKETEDCVTSRPCRSQVRCEGFTCAQTGRCINRRLLCNGDNDCGDQL
DEANCRRIYKKCQHEMDRYWAIDTLASGLNLFTSSLEGPVLDHRYYDGGCSPHYILNTRF
RKPYNVESYTPKTQGKYEFALTEYESYADFEHNITERTAAMSSFSFGFKIPLLVECCYDM
ASFNGQHFISRIKEFAHTKSTFLHARSDLEVAHYKLKPRNLMLHYEFLQRIKRLPLEYSY
GEYRDLFRDYGTHYITEAILGGTYEYTLIMNQEAMERADFSLDDVQECAKHGFKIRVPIK
VVSVKVGVSANLCDAILKEVEDRNKRKTVVNDLVVFVRGGASEHITTLAYKELPTAELMQ
EWGDAVQYNPSIIKIKAEPLYELVTATNFAYSSTVRQNMKQALEEFQKEVSSCRCAPCQG
NGVPVLKGSRCDCICPVGFRGTACEVTSRNDVPIDGKWNCWSEWSSCSGGQKTRHRQCNN
PPPQNGGSPCSGPDSERLNC
Download sequence
Identical sequences G3SS44
ENSLAFP00000002744 ENSLAFP00000002744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]