SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002804 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002804
Domain Number 1 Region: 53-427
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.02e-47
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 544-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000022
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002804   Gene: ENSLAFG00000003369   Transcript: ENSLAFT00000003369
Sequence length 645
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_10:20163836:20317873:1 gene:ENSLAFG00000003369 transcript:ENSLAFT00000003369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRADPGMLGMSLFLLLLGLLPPTEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAV
TDVDHDGDFEIVVAGYNGPNLVLKYDRTLKRLVNIAVDERSSPYYALRDRQGNAIGVTAC
DIDGDGREEIYFLNTNNAFSGVATYSDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSV
ACVDRTGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGG
RGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADF
NRDGKVDIVYGNWNGPHRLYLQMNVHGKVRFRDIASPKFSMPSPVRTVIAADFDNDQELE
VFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDL
ILSHGESMAQPLSVFRGNQGFSNNWLRVVPRTRFGAFARGAKVVLYTKRSGAHLRIIDGG
SGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRSVASGEMNSVLEIPYPRDEDKFQDP
APLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSQGYEPNE
DGTACVAQVAFLGGYPSAAFRLSEPLSRASYLFLGLGLCLQLYAL
Download sequence
Identical sequences G3SS90
ENSLAFP00000002804 ENSLAFP00000002804 XP_003409031.2.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]