SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003128 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003128
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily PH domain-like 3.35e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000274
Further Details:      
 
Domain Number 2 Region: 365-401
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0000000000183
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003128
Domain Number - Region: 182-193
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003128   Gene: ENSLAFG00000003748   Transcript: ENSLAFT00000003748
Sequence length 405
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_9:76446802:76516453:-1 gene:ENSLAFG00000003748 transcript:ENSLAFT00000003748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEQSICQARASVMVYDDTSKKWIPIKPGQQGFSRIHIYHNTASNTFRVVGVKLQDQQVVI
NYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIINSQEGGPSA
QRQAQNGPSPDEMDIQRRQVMEQQQQRQEPLERRTSATGPILPPGHPSSTASAPLSCSGP
PPPPPPPVPPPPPLPAGGAQGSSHDEGSVSGLAAALAGAKLRRVQRPEDASGGSSPSGTS
KTDPNRASSGGGGGGLMEEMNKLLAKRRKAASQTDKPADKKEDESQTEDPSTSPSPGTRA
ASQPPNSSEASRKPWERSNSVEKPVSSLLSRTPSVAKSPEAKSPLQSQPHSRMKPAGSVN
DVALDALYFDRMKQEILEEVVRELHRVKEEIIEAIRQELSGISTT
Download sequence
Identical sequences G3ST02
ENSLAFP00000028383 ENSLAFP00000003128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]