SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003234 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003234
Domain Number 1 Region: 1229-1566
Classification Level Classification E-value
Superfamily NHL repeat 9.68e-25
Family NHL repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 924-999
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000981
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 1462-1509,1537-1555,1582-1695
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000314
Family YVTN repeat 0.048
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003234
Domain Number - Region: 677-702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000712
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 774-799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00195
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 744-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 610-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00405
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 645-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00544
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 800-840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00703
Family EGF-type module 0.095
Further Details:      
 
Domain Number - Region: 580-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0684
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003234   Gene: ENSLAFG00000003864   Transcript: ENSLAFT00000003864
Sequence length 2766
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:89740665:90801684:1 gene:ENSLAFG00000003864 transcript:ENSLAFT00000003864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKDRRHRSLTRGRCGKECRYTSSSLDSEDCRVPTQKSYSSSETLKAYDHDSRMHYGNR
VTDLVHRESDEFPRQGTNFTLAELGICEPSPHRSGYCSDMGILHQGYSLSTGSDADSDTE
GGMSPEHAIRLWGRGIKSRRSSGLSSRENSALTLTDSDNENKSDDENGRPVPYYQLSCSL
LPSSPCPRSLYCPPLSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSSGP
PNHHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESV
QLQDSWVLNSNVPLETRHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSR
KAFKLKKPSKYCSWKCAALSAIAAALLLAVLLAYFIAMHLLGLNWQLQPADGHTFNNGIR
TGLPGNDDVATMPSGGKVPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFL
KFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAV
FVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHGNGECVSGLCHCFPGFLG
ADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPLNQCIDPSCGGHGSCIDGNCVCS
AGYKGEHCEEVDCLDPTCSSHGVCVNGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPD
TGLCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGT
CKDGKCECREGWNGEHCTIDGCPDLCSGNGRCTLGQNSWQCVCQTGWRGPGCNVAMETSC
ADNKDNEGDGLVDCLDPDCCLQSACQNSPLCRGSRDPLDIIQQGQTALPVVKSFYDRIKL
LAGKDSTHIIPGDNPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTF
DLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFVRPD
PIIISSPLSTFFSAAPGQNPIVPETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKITMT
QSTVPLNLIKVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGF
EYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQP
AIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNV
TSILELRNKEFKHSNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRIKSLSGSKDLAGNSEV
VAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIIST
LLGSNDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSI
IAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNG
EICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIR
AVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTEL
IDNNGNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGL
LATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVIT
NLSSVEASYTVVQDQVRNSYQLCNNGTLRVMYANGMGVSFHSEPHVLAGTITPTIGRCNI
SLPMENGLNSIEWRLRKEQIKGKVTIFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFT
LRIIYDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFAD
GKVWSYSYLDKSMVLLLQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYN
PPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGV
LKMVNLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHDNSFRIASIKPVIS
ETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMF
RSLMYWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDL
NGNLHLLNPGNNVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTR
AYNKVSGWTVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYY
DLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMV
IGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWKNVGKEPAPFNLYMFKSNNPLSN
ELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQLITGIQQ
TTERHNQAFMALEGQVISKKLHASIREKAGHWFATTTPIIGKGIMFAIKEGRVTTGVSSI
ASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGAADSDLVTLGTTIGRKVLESGVN
VTVSQPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAW
AKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQ
NEMGKR
Download sequence
Identical sequences G3ST79
ENSLAFP00000003234 ENSLAFP00000003234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]