SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003251 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003251
Domain Number 1 Region: 150-524
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.45e-94
Family Phosphonoacetate hydrolase 0.034
Further Details:      
 
Domain Number 2 Region: 616-854
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.94e-24
Family DNA/RNA non-specific endonuclease 0.012
Further Details:      
 
Domain Number 3 Region: 51-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000314
Family Somatomedin B domain 0.0035
Further Details:      
 
Domain Number 4 Region: 100-140
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000157
Family Somatomedin B domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003251   Gene: ENSLAFG00000003881   Transcript: ENSLAFT00000003883
Sequence length 874
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:28784929:28893117:-1 gene:ENSLAFG00000003881 transcript:ENSLAFT00000003883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEKALSMEEPVKKNTVQKYKIICIVLLALLVIVSLGLGLGLGLRKPETQGSCRRKCFD
SSFRGLEGCRCDAGCKDRGDCCWDFEDTCVESTRIWTCNKFRCGETRLGSSLCSCSDDCL
QKKDCCTDYMSVCQGETGWVKEECSTAEQSQCPEGFDLPPVILFSMDGFRAEYLQTWHTL
MPNINKLKTCGVHSKYMRAVYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVNLNKNFSLS
SAEKQDPVWWGGQPLWLTAMYQGLKAGTYFWPGSDVAINGTFPSKYMLYRNSVSFEERLF
TLLKWLDLPKAERPNFYALYVEEPDSAGHIGGPVSASVVQALQLVDQAFGMLMEGLKQRN
LHNCVNIILLADHGMDQTSCDKLEYMTDYFSQINFYMYEGPAPRIRSGNIPQDFYSFNSE
GIVKNLSCRKSDQHFKPYLTPDLPKRLHYAKNVRIDKVHLMMDQQWLGVRSKAFTSCGGG
NHGYDNEFKSMEAIFLAHGPSFKEKTEVEPFENIEVYNLMCDLLHIQPAPNNGTHGSLNH
LLKAPFYKPSHPEEVSKSSVCRFTNLLPTDSLDCSCSELQNNTVLEHVNQRLNLTSNEIT
ATEKENMPFGRPRVMQKNKEHCLLYHREYVSGFGKAFRMPMWSSYTTPKPGDTSPLPPPV
PDCLRADVRVAPSESQKCSFYLADENITHGFLYPPANNRTSDGQYDALITSNLVPMYEEF
KKIWHYFHNVLLIRFAVERNGVNVVSGPVFDYNYDGHFDASDEITKHVGNTSVPIPTHYF
VVLTSCKNKSHTPNDCPGWLDVLPFIIPHQPTNMESCPEDKPEAVWIEERWHAHIARVRD
VELLTGLDFYQEKAQPVSEILQLKTYLPILETLI
Download sequence
Identical sequences G3ST94
ENSLAFP00000003251 ENSLAFP00000003251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]