SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003562 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003562
Domain Number 1 Region: 31-481
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.88e-95
Family Integrin alpha N-terminal domain 0.000000000000883
Further Details:      
 
Domain Number 2 Region: 773-998
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-56
Family Integrin domains 0.00028
Further Details:      
 
Domain Number 3 Region: 481-633
Classification Level Classification E-value
Superfamily Integrin domains 3.09e-34
Family Integrin domains 0.00011
Further Details:      
 
Domain Number 4 Region: 634-767
Classification Level Classification E-value
Superfamily Integrin domains 1.67e-33
Family Integrin domains 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003562   Gene: ENSLAFG00000004271   Transcript: ENSLAFT00000004271
Sequence length 1036
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_31:25572245:25587128:-1 gene:ENSLAFG00000004271 transcript:ENSLAFT00000004271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQSFVSTACLWLLGWAQLLLGPGTPPTWALNLDLMRLTVYTGPNGSHFGFSLDFYKDSKG
SVAIVVGAPRALGPRREETGGVFLCPWKAEGGQCTSLSFHLTDDNQNVGYQTLQTFKAGQ
GLGASVVSWRDNVVACAPWQHWNVLEKTEEAEKTPVGSCWVAHLQSGSRAEYSPCRARIM
SKIYEQNRFMLDRRYCEVGFSSVVTQAGELVLGAPGGYYFLGLLVRAPVANIVSSYSPGT
LLRSVPSQSFTSDSSSQEFFDGYRGYSVAVGEFDGSPNTTEYVFGAPTWSWTLGAVEILN
SDHRTLQRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMDSRSDRKLAEVGRVYLY
LQPRGTYVLGAPNLLLTGTQLYGRFGSAIAPLGDLDRDGYNDLAVAAPYGGPSGRGQVLV
FRGQSEGLSSRPSQVLDSPFPKGSGFGFSLRGATDIDDNGYPDLLVGAYGASKVAVYRAQ
PVVMASVQLLVQDSLNPAVKDCILTQTNKAVSCFNIQMCVGATGHNITEKLHLNAELQLD
RQKPRQGRRVLLLGSQQASTTLSLDLSRRHSPICHTTKAFLRDEADFRDKLSPIVFSLNV
SLQPEEAGLAPALLLLGDTHVQEQTRIILDCGEDHLCVPQLQLTGEMRGSPLLIGADSVL
KLQMDAVNEGEGAYEAELVVHLPPGAYYMQALSDIQGYERLICNQKKENETKMVLCELGN
PMKKDARIQITMLLSVENLEEVGEYMSFQLQIRSKNSQNPNSEMVLLNVPVWAEAHVELR
GNSFPASLVVPAEEGDRKTESSDSWGPRVEHTYELHNKGPGAVSGLRLNLQFPSQSQPSD
LLYILDVQPQGGLQCSPQPSPKPLQLDQRLPTPSQPPVYPEHHKRERRQALQPGSQQPSE
LQDPILVNCDSAPCTVVQCELQEMAPGQRAMVTVLAFLWLPSLRQRPLDQFVLQSHAWFN
VSALPYAVPALSLPRGEALVQTQLLRVLEERDVPIWWILVGMLGGLLLLTLLVLAMWKVG
FFKRNRPPLEEEDEEE
Download sequence
Identical sequences G3STY0
ENSLAFP00000003562 ENSLAFP00000003562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]