SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003640 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003640
Domain Number 1 Region: 31-470
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.75e-105
Family Integrin alpha N-terminal domain 0.0000000000000617
Further Details:      
 
Domain Number 2 Region: 771-994
Classification Level Classification E-value
Superfamily Integrin domains 4.66e-66
Family Integrin domains 0.00000000517
Further Details:      
 
Domain Number 3 Region: 471-630
Classification Level Classification E-value
Superfamily Integrin domains 4.71e-46
Family Integrin domains 0.0000000462
Further Details:      
 
Domain Number 4 Region: 631-764
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-37
Family Integrin domains 0.000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003640   Gene: ENSLAFG00000004362   Transcript: ENSLAFT00000004366
Sequence length 1045
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_3:40555820:40658472:-1 gene:ENSLAFG00000004362 transcript:ENSLAFT00000004366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQSRRRWFLCLRRLLFLLPGLLLPLCGAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSNRRCQPIEFDATGNRDYAKNDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGKLISDQVAEIVSKYDPKVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGYNATDIAIAAPYGGEDKKGVVYIFNGRSTGLHVVPS
QILEGQWAARSMPPSFGYSMKGATDIDRNGYPDLIVGAFGVDRAVLYRARPVITVNAGLE
VYPSILNQDNKTCPLPGTSLKVSCFNVRFCLKADGKGALPRMLNFQVELLLDKLKQKGAI
RRALFLHNRSPGHSKNMTISRGGQMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRMA
ADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLI
VKAQNQGEGAYEAELIVSIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMK
AGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPMVSYKADLAVLAAVEIRGVS
SPDHIFLPIPNWELKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLSLQWPYKYNNNTL
LYILQYDIDGPMNCTSDMEINPLRIKTTEKNDTIAGQGDRNHLITKRDLTLSEGDVHTLG
CGIAECLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPY
KNLPIEDIFNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVLVMYRMGFFKR
VRPPQEEQEREQLQPQENGEGNSET
Download sequence
Identical sequences G3SU46
ENSLAFP00000003640 ENSLAFP00000003640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]