SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003716 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003716
Domain Number 1 Region: 2-203
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-55
Family DBL homology domain (DH-domain) 0.0000256
Further Details:      
 
Domain Number 2 Region: 189-335
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 449-580
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-32
Family DEP domain 0.0013
Further Details:      
 
Domain Number 4 Region: 351-466
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-27
Family DEP domain 0.0035
Further Details:      
 
Domain Number 5 Region: 567-647
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000186
Family PDZ domain 0.028
Further Details:      
 
Domain Number 6 Region: 652-715
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000146
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003716   Gene: ENSLAFG00000004449   Transcript: ENSLAFT00000004452
Sequence length 1601
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_19:47772553:47994767:-1 gene:ENSLAFG00000004449 transcript:ENSLAFT00000004452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTERDYVGTLRFCSRAFLHRIRQNVADSAEKGITEENVKILFSNIEDILEVHKDFLAALE
YCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLL
GGRKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNIN
ETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLL
VYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNG
WKIHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMISEKGEKLYH
MMMSKKVNLIKDRRRKLSTVPKCFFGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHH
VSDKHQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDHHLKT
YKSVLPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHAD
EEMEGTSNKNKQLRNDFKLVENILAKRLLILPQEEDYGFEIEEKNKAVVVKSVQRGSLAE
MAGLQVGRKIYSINEDLVFLRPISEVESILNQSFCSRRPLRLLVATKAKEVIKVPDQPEA
LCFQIRGATPPHVYAVGRGSEAAAAGLCAGQCILKVNGNNVMNEGALDVLEHFQAFRSRR
EEALGLYQWIYHTHEDAQEARASQEAPGEDPSGEGSREEDQPDSAFPLQSLGSQLTLHED
SPMVSLTVDNVHLEHGVVYEYVSTAGVKCHVLEKIVEPRGCFGLAAKILEAFAAEDSVFV
QNCGRLMALSSVIMTMPHYEFRNICDTKLESITQRIACYQEFAAQLKSRVSPPFKQASLE
PHLLCGLDFCPTNCHINLMEVSYPKTTPSIGRSFSIRFGRKPSLIGLDPEQGHLNPMSYT
QHCITTMAAPSWKCLSATDGDPQGQGLNDSSFGLTNGALGQEDRGLSFLLKQEDREIQDA
YLQLFTKLDVALKEMKQYVTQINRLLSTITEPTLGGSCDPPLAEEASSSPLVSEENEMDR
ADHGGIKKVCFKVSEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEM
GSGDELPCDMRISSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMDHSLQ
EFKQKEEYTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDVE
LQLRRDAIFCQALVAAVCTFSEQLLAALSYRYNNNGEYEESSRDASRKWLEQVAATGVLL
HCQSLLSPATVKEERTMLEDLWEALSELDNVAFSFKQLDENYVANTNVFYHIEGSRQALK
VVFYLDSYHFSKLPSRLESGASLRLHTVLFTKALENVEALTPPGSMASEDLQQEINAQSL
EKVQQYYRKLRAFYLERSNLPTDTSTTAVKIDQLIRPINALDELCRLMKSLIHPKPGTSG
SLGASLIPISSELCYRLGACQIAMCSTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATD
IMRKQGPQGGDSAKNLRVKDQMPRLFPSLYCLCQPPVDGDL
Download sequence
Identical sequences G3SUA7
ENSLAFP00000025903 ENSLAFP00000003716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]