SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003840 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003840
Domain Number 1 Region: 728-1099
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.58e-98
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000000000368
Further Details:      
 
Domain Number 2 Region: 526-725
Classification Level Classification E-value
Superfamily ARM repeat 5.06e-62
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00000000385
Further Details:      
 
Domain Number 3 Region: 351-524
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.54e-52
Family PLC-like (P variant) 0.0000000484
Further Details:      
 
Domain Number 4 Region: 146-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.82e-51
Family Ras-binding domain, RBD 0.0000000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003840   Gene: ENSLAFG00000004597   Transcript: ENSLAFT00000004599
Sequence length 1112
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_5:76745431:76774095:1 gene:ENSLAFG00000004597 transcript:ENSLAFT00000004599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLENAEPPVVLRADNFRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRNSKTRETVLLH
VAGHGNVEQVKAQVWLRALETSVAADFYHRFGPDHFLLLYQKKGQWYEIYDRHQVVQTLD
CLRYWKMLHRSPGQIHVVQRKALSVETVAFQQQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLSKKIANNCIYIVIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLSHRRTSPKPFTEEVLWNVWLEFGIKI
KDLPRGALLNLQIYCGKAPALSGKASAETPGSEPKGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQISGKGEDQGSFSADKLTSATNPDKESSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKYPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQRVTIDIKSVSVEKYDVSSQVISQLKQKLEDLQNSNLP
KSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSKETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPLEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGISKERVPFVLTPDFLFVMGTSGRKTSPHFQKFQVSCLAFHHLQ
DVCARAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLD
QIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA
Download sequence
Identical sequences G3SUK0
ENSLAFP00000003840 ENSLAFP00000023304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]