SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003868 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003868
Domain Number 1 Region: 63-238
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-41
Family DBL homology domain (DH-domain) 0.0000843
Further Details:      
 
Domain Number 2 Region: 248-363
Classification Level Classification E-value
Superfamily PH domain-like 4.45e-35
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003868   Gene: ENSLAFG00000004633   Transcript: ENSLAFT00000004634
Sequence length 521
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_48:8679055:8682343:1 gene:ENSLAFG00000004633 transcript:ENSLAFT00000004634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLRKAYSFDRNLGQSLSEPAHHCHHATIAAACHGPEAGGGAQLGSSPTVPPPGTSEPRS
PNRLQLVLAEMVATEREYVRALDYTMENYFPELDRPDVPQGLRGQRAHLFGNLEKLRDFH
RHFFLRELEACTRHPPRVAYAFLRHRVQFGMYALYSKNKPCSDALMTSYGHTFFKDKQQA
LGDHLDLASYLLKPIQRMSKYALLLQELARACGGPSELSALRAAQSLVRFQLRHGNDLLA
MDAIQGCDVNLKEQGQLVRQDEFTVRAGRHKSLRRVFLFEELLLFSKPRRGPTGIDTFAY
KRSFKMADLGLTESCGDGNLSFEIWFRRRKARDTFVLQAASSATKQAWTTDISRLLWRQA
VHNKEVRMAEMVSMGVGNKAFQDIAPSEEAINDRTINYVLKYREVRSRASIAVAPLDYDS
PYLGASNSLPGDPASSSVLGPLNLHLYRDPALLGRWPLYATNFLEEALLEAEAELGSQPS
LTPEDSEVSSQCLSASGSSGSDSSCVSGQALSRGLEDLSYV
Download sequence
Identical sequences G3SUM2
ENSLAFP00000003868 ENSLAFP00000003868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]