SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004197 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004197
Domain Number 1 Region: 529-775
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.13e-63
Family Nuclear receptor ligand-binding domain 0.000000000485
Further Details:      
 
Domain Number 2 Region: 417-499
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.2e-27
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004197   Gene: ENSLAFG00000005015   Transcript: ENSLAFT00000005015
Sequence length 776
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:61261778:61370936:-1 gene:ENSLAFG00000005015 transcript:ENSLAFT00000005015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKESFKPPSREETLSSVLGRERGNVMDFYKTLRGGATVKIPASLPPLAAASPSDSKQQ
RLLVDFPKGSVSNEQQPDLSKAVSLSMGLYMGETEAKVMGSDLGFPQQGQISLSSGETDF
RLLEESIANLNKSTSVPENPKSSTSAAGSAASTEKEFPKTHSDVSSEQQNLKGQTGTNDG
NVKLYTTDQSTFDILQDLEFSGSPGKETNESPWRSDLLIDESCLLSPLAAEEESFLLEGN
SNEDCKPVVLPDTKPKIKDNGDLILSSPSSMPLPQVKTEKEDFIELCTPGVIKQEKLGPV
YCQSTFSGANIIGNKTSAISVHGVSTSGGQMYHYDMNTASHSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAAMGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LQAGMNLEARKTKKKIKGIQQATAGVSQETSENPINKTVVPATLPQLTPTLVSLLEVIEP
EVLYSGYDSSVPDSTWRILTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWM
FLMAFALGWRSYRQAGGSLLCFAPDLVINEQRMSLPYMYDQCKHMLYVSSELQRLQVSYE
EYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKL
LDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLTEIISNQIPKFSNGKIKKLLFHQK
Download sequence
Identical sequences G3SVD4
ENSLAFP00000004197 ENSLAFP00000004197 XP_003404624.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]