SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004279 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004279
Domain Number 1 Region: 187-253
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-19
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 62-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000183
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000171
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000004279
Domain Number - Region: 122-150
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0174
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004279   Gene: ENSLAFG00000005114   Transcript: ENSLAFT00000005112
Sequence length 382
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_33:15886425:16128325:-1 gene:ENSLAFG00000005114 transcript:ENSLAFT00000005112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDGLKMEENFQSAIETSASFSSLLGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCV
LCASCKEPLETTCFYRDKKLYCKYDYEKLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCF
CCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEENLCKSAHG
AGKGAAEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQ
VWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSTGMEGIMNPYTSLPTPQQLL
AIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGP
LQSRVGNPIDHLYSMQNSYFTS
Download sequence
Identical sequences G3SVK6
XP_003415260.1.64505 ENSLAFP00000004279 ENSLAFP00000004279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]