SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004389 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004389
Domain Number 1 Region: 518-751
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-45
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 223-366
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-41
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 860-1029
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-33
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 4 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 737-859
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-27
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Domain Number 6 Region: 42-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-23
Family First domain of FERM 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004389   Gene: ENSLAFG00000005242   Transcript: ENSLAFT00000005243
Sequence length 1046
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_11:6849947:7146331:-1 gene:ENSLAFG00000005242 transcript:ENSLAFT00000005243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEQRPTPGSRLGAPENSGISTLEHGQKPPPTPSGKLISIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHAQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSRIHSIRSLASQPAEPNSEVPKQSPQSTGLTYGEGAELPGGQSCQQGRELKVSAE
EPGPQQSPSLQKSPLGNKKADGAIMVTMEEEEEAVKDRSQQSKPKTSHPQTGSLTGSPHL
SELSVNSQGGAAPANVTLSPNLSPDTKQASPLVSPLLNDQACPRTDDEEEVRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDSMPETLKSLIFPNFEPLHKFHTSFLK
EIEQRLALWEGRSNAHIQGDYQRIGDVMLKNIQGMKPLAVHLWKHNEALEGLENGIKGSR
RLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAE
ITEMVAQLHGTMIKMENFQKLHELKKDLIGVDNLVIPGREFIRLGSLSKLSGKGLQQRMF
FLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDQWGVPHCLTLRGQRQSIIVAAS
SRSEMQKWVEDIQMAIDLAEKSSGPTPELLASSPPDNKSPEEGMAVDQESEDDLSASRTS
LERQAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNF
CLFFYKSHQDSHPLASLPLLGYSLTVPSESENIHKDYVFKLHFKSHVYYFRAESEYTFDR
WMEVIRSATSSASRTHILSHKESHVY
Download sequence
Identical sequences G3SVU5
ENSLAFP00000004389 ENSLAFP00000004389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]