SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004429 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004429
Domain Number 1 Region: 50-375
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.34e-74
Family Pancreatic carboxypeptidases 0.00000111
Further Details:      
 
Domain Number 2 Region: 375-471
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.46e-21
Family Carboxypeptidase regulatory domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004429   Gene: ENSLAFG00000005287   Transcript: ENSLAFT00000005287
Sequence length 476
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_37:675234:801244:1 gene:ENSLAFG00000005287 transcript:ENSLAFT00000005287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPGGRALLALCGTLAACGWLLGAQAQEPGTSAAGMRRRRRLLQEDGISFEYHRYPELR
EALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVG
RELLIFLAQYLCNEYQKGNETIVNLIHNTRIHIMPSLNPDGFEKAASQPGDLKDWFVGRS
NAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNTKLAPETKAVIHWIMDIP
FVLSANLHGGDLVANYPYDETRSGSAHEYSSCPDDAIFRSLARAYSSFNPAMSDPNRPPC
RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKSYWED
NKNALISYLEQIHRGVKGFIRDLRGNPIANASISVEGIDHDVTSAKDGDYWRLLAPGNYK
LTASAPGYLAITKKVAVPYSPAVGVDFELESFSERKEEEKEELMEWWKMMSETLNF
Download sequence
Identical sequences G3SVY3
XP_003415843.1.64505 ENSLAFP00000004429 ENSLAFP00000004429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]