SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004669 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004669
Domain Number 1 Region: 233-431
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-48
Family DBL homology domain (DH-domain) 0.0000000849
Further Details:      
 
Domain Number 2 Region: 424-547
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-34
Family Pleckstrin-homology domain (PH domain) 0.00000259
Further Details:      
 
Domain Number 3 Region: 1-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-26
Family Calponin-homology domain, CH-domain 0.00085
Further Details:      
 
Domain Number 4 Region: 162-231
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-24
Family SH3-domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004669   Gene: ENSLAFG00000005561   Transcript: ENSLAFT00000005565
Sequence length 775
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_89:4476648:4587483:1 gene:ENSLAFG00000005561 transcript:ENSLAFT00000005565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLVPGSVEKYCLEP
QTEADCTNNINDFLKGCATLQVEVFDPEDLYLGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSSANSSQTNPQGAVSSTAPGLQRQSKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAGKGLETAPLTKN
YYAVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSSVEFTSLLGNFEEVCTFQQTLC
QALEECSKFPENQQKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDDLDQFMESQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKTLGNVIFMSQVMVQCGACEEKEERYLMLFSNVLLM
LSASPRMSGFIYQGKISIAGMVVTRLDEIEGNDHTFEITGNLTERLVVHCNNSQDLQEWL
EQLCKLTRGPASCSSLSKTSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLR
PSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQILK
VIEAYCTSANFQQGRSSSTRKDSVPQVLLPEEEKLIIEETRSNGQTITEEKSLVDTVYAL
KDEVKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRAESSSKTSILP
Download sequence
Identical sequences G3SWH3
ENSLAFP00000004669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]