SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004695 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004695
Domain Number 1 Region: 43-238
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 3.92e-77
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000099
Further Details:      
 
Domain Number 2 Region: 319-449
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 5.36e-54
Family C-terminal domain of adenylylcyclase associated protein 0.00000022
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000004695
Domain Number - Region: 230-266
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00194
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004695   Gene: ENSLAFG00000005592   Transcript: ENSLAFT00000005593
Sequence length 451
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_34:19404574:19414536:1 gene:ENSLAFG00000005592 transcript:ENSLAFT00000005593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHASDMHCGYGDSPSKAGAAPYVQAFDSLLASPVAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSELLAPISEQIQEVTTFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPP
PVPTSAGSDDSASRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPLRSGPKPF
SAPKPGVSPSPKPAAKREPALLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTT
LQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFVSF
Download sequence
Identical sequences G3SWJ2
ENSLAFP00000004695 ENSLAFP00000004695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]