SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004724 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004724
Domain Number 1 Region: 611-836
Classification Level Classification E-value
Superfamily vWA-like 6.68e-63
Family Integrin A (or I) domain 0.00028
Further Details:      
 
Domain Number 2 Region: 45-238
Classification Level Classification E-value
Superfamily vWA-like 1.53e-55
Family Integrin A (or I) domain 0.00027
Further Details:      
 
Domain Number 3 Region: 239-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.27e-18
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 4 Region: 323-447
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.26e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 482-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.69e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 447-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000231
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 893-934
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000000034
Family Chicken cartilage matrix protein 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004724   Gene: ENSLAFG00000005628   Transcript: ENSLAFT00000005629
Sequence length 937
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_8:44758276:44919038:1 gene:ENSLAFG00000005628 transcript:ENSLAFT00000005629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMLLGCLLLIFGQVLLLPAEARERPRSRSISRGRHTRTHPQTALLESSCENKRADLVF
IIDSSRSVNTYDYAKVKEFIVDILQFLDIGPDLTRVGLLQYGSTVKNEFSLKTFKRKSEV
ERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEV
AAKARDTGILIFAIGVGQVDFNTLKAIGSEPHKDHVFLVANFSQIESLTSVFQTKLCTVH
MCSVLEHNCAHFCVNTPGSYVCRCKEGYILNSDQTTCRIQDLCAVEDHACEQLCVNVPGS
FVCQCYSGYTLAEDGKRCVAVDYCASENHGCEHECVNADNSYICRCREGFALNSDEKTCT
KIDYCASSNHGCQHECVNTDDSYSCRCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNT
EESYYCRCRRGYTLDPNGKTCSRVDHCAQNDHGCEQLCVNTEESFICQCSEGFLINEDLK
TCSRVDYCLLSDHGCEYSCINMDTSFACQCPEGYVLRSDGKTCAKLDSCALGDHGCEHLC
VSRGNSFVCQCFEGYTLHEDGKTCRRKDVCQAVDHGCEHICVNNDDSYICKCLEGFLLTD
DGKHCRRKDICKSTYHGCEHICVNNGNSYTCKCSQGFVLAEDGRRCKRCTEGPVDLVFVI
DGSKSLGEENFEIVKQFVTGIIDSLAISPKAARVGLLQYSTQVRTEFTLKSFSSARDMKK
AVAHMKYMGKGSMTGLALKHMFERSFTQVEGARPLSLRVPRVVIVFTDGRAQDDVSEWAS
KAKANGITLYAVGVGKAIEEELQEIASEPTDKHLFYAEDFSTMGEISEKLKKGICEALED
SDGSQDSPAGEMPKRVHQPTVQHRYLFEGDSLSRSTQKLSQSTKASGSPLEEKHDQCKCE
NLIMFQNLANEEVRKLTQRLEEMTQRMEVLENRLRYR
Download sequence
Identical sequences G3SWL2
ENSLAFP00000004724 ENSLAFP00000004724 XP_003408455.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]