SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004910 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004910
Domain Number 1 Region: 172-186,370-583
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-59
Family Nuclear receptor ligand-binding domain 0.0000938
Further Details:      
 
Domain Number 2 Region: 104-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-29
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004910   Gene: ENSLAFG00000005858   Transcript: ENSLAFT00000005857
Sequence length 596
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:89528296:89570969:-1 gene:ENSLAFG00000005858 transcript:ENSLAFT00000005857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTGLDHNPQGKQFIPSKVILARQDSTPGK
VFLTAPDATGVNQLFFTTPDLSAQHLQLLTDNSSPDQGPNKVFDLCVVCGDKASGRHYGA
VTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCER
KPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETSRSAGLLDSGMFVNVHQS
GMKTESAMLMTPDKAESCQGDLSTLASVVTSLANLGKTKDLSQNSNEVPMIESLNNGDAS
LCEFHQEIQTNGDVSRAFDTLAKALTPGESTACQSSESMEGSVHLIAGDASINYIEKEGP
LLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVK
AYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSTERRKLLMDHIFKLQEFCN
SMVKLCIDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEFQDYITKTYPDDTYRL
SRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHGI
Download sequence
Identical sequences G3SX14
ENSLAFP00000004910 ENSLAFP00000004910 XP_003405663.1.64505 XP_010597654.1.64505 XP_010597662.1.64505 XP_010597668.1.64505 XP_010597679.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]