SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004926 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004926
Domain Number 1 Region: 308-397
Classification Level Classification E-value
Superfamily Immunoglobulin 3.79e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 150-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000004926
Domain Number - Region: 222-285
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000196
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number - Region: 491-549
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00235
Family Carboxypeptidase regulatory domain 0.046
Further Details:      
 
Domain Number - Region: 50-174
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.00248
Family Vitelline membrane outer protein-I (VMO-I) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004926   Gene: ENSLAFG00000005873   Transcript: ENSLAFT00000005873
Sequence length 1220
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_59:11022918:11043156:-1 gene:ENSLAFG00000005873 transcript:ENSLAFT00000005873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGTKACIVLLLVLEVTSVLGRQALLTQSVRRVQPGKGTRSIFVKPADPLESPGEWTTWF
NIDHPGGQGDYERLDAIRFYYGDRVCARPLRLEARTTNWIPAGSTGQVVHGSPREGFWCL
NREQWSGQNCSNYTVRFLCPPGSLRRDTERTWSPWSPWSKCSAACGHTGVQTRTRTCLAE
TMSLCNEATEEGRLCVSQECTACDLTCPMGQVNADCDACMCQDFVLQGAVSLPGGAPASG
ATVYLLTKTPKQLTQTGSSGRFRVPGLCPDGKSILKITKAKFAPIMLTMPKTSLKVVTIN
AEFMRAETPYIIMNPETKARRAGQSVSLCCKATGKPSPDKYFWYHNDTLLDPSLYKHESK
LVLRNLQRDQGGEYFCKAQSDAGAVKSQVAQLTVIAPDETACNPTPESYLIRLPHDCFQN
ATNSFYYDVGHCPIKICAGRQDNGIRCKDAVNCCGISKTEEREIQCSGYTLPTKVAMQCS
CQRCTETRSIVRGRVSAADNGEPMRFGHVYMGGNRVSMTGYKGTFTLHVPQDTERLVLTF
VDRLQKFINTTKVLPFNKKGSTVFHEIKMLRRKEPITLEALETNIIPLGEMIGEDPVAEL
EIPSKSFYRQNGEPYIGKVKASVTFLDPRNISTATAAQSDLNFINDEGDTFPLRTYGMFS
VDFTDEATSESLNVGKVKVHLDSAQVKMPEHVPMMKLWSLNPDTGLWEEESDFKFESQRR
NKREERTFLVGNMEIRERRLFNLDVPENRRCFIKVRAYRSERFLPSEQIQGVVVSVINLE
PRTGFSTNPRAWGRFDSVITGPNGACLPAFCDDQSPDAYSAYVLASLSGEELEAVESSPK
FNPNAIGVPQPYLNKLKYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLRA
CEEAPPSAAHFRFYQIEGDRYDYNTVPFNEYDPMSWTEDYLAWWPKPMEFRACYIKVKIV
GPLEVNVRSRNMGGTHRRTVGKLYGIRDVKSTRDRDQPNVSSACLEFKCSGMLYDQDRVD
RTLVKVIPQGSCHRVSVNSMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNYGIYTVTD
QDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCVERQVGRQSAFQYLQSTPARLP
SAGNIRGTLASRRQQRARRAGLRRRGGGLSEASWDCSTAAEQLSLLVLRPLFPSPHVTAI
VRLTHKLSLVNLSTSVLVQF
Download sequence
Identical sequences G3SX23
ENSLAFP00000004926 ENSLAFP00000004926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]