SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005389 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005389
Domain Number 1 Region: 124-419
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-90
Family Nuclear receptor ligand-binding domain 0.00000000232
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.36e-29
Family Nuclear receptor 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005389   Gene: ENSLAFG00000006418   Transcript: ENSLAFT00000006418
Sequence length 424
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:33530139:33573640:-1 gene:ENSLAFG00000006418 transcript:ENSLAFT00000006418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMAASTSLPDPGDFDQNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIITILLEAHHKTYDPTYADFTQFRPPVHGVEGGGSHPSSSSLHTPSFSGE
SSSSDHYTTSADMMEPSSFSNLDLKEGDSDDPSETLDLSQLSMLPHLADLVSYSIQKVIG
FAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGSEDYKYRVSDVTKA
GHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTL
QTYIRCRHPPPGGHLLYAKMIQKLADLRSLNEEHSKQYRCLSFHPECSMKLTPLLMEVFG
NELS
Download sequence
Identical sequences G3SY52
ENSLAFP00000005389 XP_003405789.1.64505 XP_010594438.1.64505 ENSLAFP00000005389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]