SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005438 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005438
Domain Number 1 Region: 52-290
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-61
Family Nuclear receptor ligand-binding domain 0.000000000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005438   Gene: ENSLAFG00000006479   Transcript: ENSLAFT00000006479
Sequence length 291
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_35:11465848:11492929:-1 gene:ENSLAFG00000006479 transcript:ENSLAFT00000006479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRKFKKFNKVRVMRALDAVALPQPVGMPNESQTLSQRITFSPSQELQFVPPLINLLVSIE
PDMIYAGHDNTKPDTSSSLLTSLNQLAERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSW
MSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYPLCLTMWQIPQEFVKLQVSQ
EEFLCMKVLLLLNTIPLEGLRSQNQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTK
LLDNLHDLVKQLHLYCLNTFIQSRALCVEFPEMMSEVIAAQLPKILAGMVK
Download sequence
Identical sequences G3SY93
ENSLAFP00000005438 ENSLAFP00000005438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]