SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005641 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005641
Domain Number 1 Region: 9-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.27e-36
Family Cap-Gly domain 0.00087
Further Details:      
 
Domain Number 2 Region: 106-346
Classification Level Classification E-value
Superfamily RNI-like 1.57e-28
Family Rna1p (RanGAP1), N-terminal domain 0.07
Further Details:      
 
Domain Number 3 Region: 439-527
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.04e-21
Family Ubiquitin-related 0.000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005641   Gene: ENSLAFG00000006718   Transcript: ENSLAFT00000006716
Sequence length 527
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_16:34835014:34874269:1 gene:ENSLAFG00000006718 transcript:ENSLAFT00000006716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTLTLDVIGRRVEVNGEYATVRFSGVVPPTAGLWLGVEWDNPERGKHDGSHEGTVYFK
CRHPTGGSFIRPNKVNFGVDFLTAVKNRYALEDGPEGDRKEQVVIIGNKPVETVGFDSII
KQQSQLSKLQEISLRNCAVNCAGEKGGIAETCPNIRKLDLSRNLLSSWEVIRMGDQLKHL
DVLNLSENKLQFPSGSPSLIGMFSALKVLVLNRTGITWAEVLQCAPGWPVLEELYLESDN
IFISERPTDVLQMLKVLDLSSNQSVGENQLFLIAHLPRLEQLILSDTGISSIHFPDAGIG
CKTSMFPSLQYLVVNDNQISQWSFINELDKLQSLHSLSCVRNPLTEGNKDAQTIRQLIIA
KIGQLKTLNKCEIPLEERRGAELDYRKAFGNEWKKAGGHQDPDKNRPNEEFLAAHPRFQL
LCLKYGAPEDEELKTPQPFMLKNQLLELTIKYPNQLDQKVIEKKLPVSMTIQKVKGLLSR
LLKVPVSELLLSYESPKMPGREFELGNDQQTLQFYSVESGDCLLVRW
Download sequence
Identical sequences G3SYP7
ENSLAFP00000005641 ENSLAFP00000005641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]