SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005735 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005735
Domain Number 1 Region: 189-321
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-38
Family Third domain of FERM 0.00061
Further Details:      
 
Domain Number 2 Region: 87-191
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 5-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.43e-24
Family First domain of FERM 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005735   Gene: ENSLAFG00000006820   Transcript: ENSLAFT00000006824
Sequence length 821
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:50384348:50547432:1 gene:ENSLAFG00000006820 transcript:ENSLAFT00000006824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPTLYCRFFLLDGTEVRVDLPKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVLHWLD
HSKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETA
VELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELS
YLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKS
KLTLVVVEDDDQGREQEHTFVFRLDNAKTCKHLWKCAVEHHAFFRLRTPGNSKSNRSDFI
RLGSRFRFSGRTEYQATHGARLRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTN
PEVHNYQPQYHPAIHPSQPRWHPHSPNVSYPLPSPVLSSSDRLPFGIEENGGTPFTAKAQ
GRHHHHHHHHHQHQHHPNYGLTLTLETKEGPLRSPGSSSKSMTKLSPGAPALFSDAAAHL
KKLELETVKAAGPWPALHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENAS
RANAQVGKEESTFVNISKKSSLQDTNVRSPIPIRVETTQPAVEKPEIKAPRVRKLTRQYS
FDEDDLPPDLAEAVGAATTATTNTTSTTTITTTQVSVPLASPKVHKVSSPQKSEGKGQPS
PVAKSPSDRGGAFTLEPGDLLMDFTEATPLAEPASAPHCAHSRCSPPLSLPMKEEPTGVC
MHPPIKTRLVGTWQGKGPARRVSSFLFLHQANFRESKLQCCPGQSSPLIPAAALRPLTET
VSTVQTVYTTRKPVSLAASAETLRQELDREKMMKRLLMTEL
Download sequence
Identical sequences G3SYX9
ENSLAFP00000005735 ENSLAFP00000005735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]