SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005793 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005793
Domain Number 1 Region: 286-613
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.03e-74
Family Pancreatic carboxypeptidases 0.0000025
Further Details:      
 
Domain Number 2 Region: 108-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.95e-17
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 618-715
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 9.22e-17
Family Carboxypeptidase regulatory domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005793   Gene: ENSLAFG00000006896   Transcript: ENSLAFT00000006897
Sequence length 727
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_19:27359306:27366018:1 gene:ENSLAFG00000006896 transcript:ENSLAFT00000006897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGPLFGPGRRARLQSAWVWGAPSASVLDLSPPATTESSVSTPAPRSSPAQPPEEKKNGT
TGQRVRIRIVKKTRVVTKVKKKITHPRPPVTTTPATTLNLPKEQTPDCPPLGLESLRVSD
GQLEASSSQSSGLGPHRGRLNIQSGLEDGDLYDGAWCSELVGKQEPQQWMEAVGAARCCR
FLLECPSSHGPLVLVSLLGLFMSPGFPTSWNCWCLSSPNKVFPANSDLETPVLNLLPEPQ
VARYIRLLPQTWLQGGASCLRAEILACPVSDPNGLFPEAPAPASSDPLDFRHHDYKGMRK
LMKQVNEQCPNITRIYSIGKSHQGLKLYVMEMSDNPGEHELGEPEVRYVAGMHGNEALGR
ELLLLLMQYLCHEFRRGNPRVTRLLTEMRLHLLPSMNPDGYEIAYRRGSELVGWVEGRWN
YQGIDLNHNFADLNTPLWEAEDNRLVPHTIPNHHLPLPTYYTLPNATVAPETWAVIEWMK
RIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAMFRWLSTVYAGSNRAMQDTD
RRVCHNQDFSLNGNIINGADWHTVPGSMNDFSYLHTNCFEITVELSCDKFPHESELPQEW
ENNKDALLTYLEQQVRMGIAGVVSDKDTELGIADAVIAVDGINHDVTTGWRGDYWRLLTP
GDYVVTASAEGYHSMTRSCRVTFEEGPFPCNFYLTKTPKQRLRELLAAGAKVPPDLRRRL
EQLRKLK
Download sequence
Identical sequences G3SZ26
ENSLAFP00000005793 ENSLAFP00000005793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]