SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005794 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005794
Domain Number 1 Region: 6-351
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.06e-22
Family Integrin alpha N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005794   Gene: ENSLAFG00000006897   Transcript: ENSLAFT00000006898
Sequence length 523
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_43:15830515:16071920:-1 gene:ENSLAFG00000006897 transcript:ENSLAFT00000006898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICFRNHSALITSVVPGDYDGDSQMDVLLTYHPQNHASGDLGAVIFWGQNQTLDPKNMTIL
NRTFQDQPLIMDFNGDLIPDVFGVTNESNQPQILLGGNLSWHPAVTTKNKMRIPHSHAFI
DLTEDFTADLFLTTQSGSNNFQFEIWQNLDGNFSVSSTLEKPQNMVVVGQSAFADFADGD
GHADHLLPGCEDENCQKSTVYLAKSGTKQWVPVLQNFSNKGTLWGFVPFVHKQRPTEISI
PLTLHIGDYNMDGYPDALAILRNTSGSNQQAFLLENVPCNNASCEGAHRMFKVYWDLSNL
NQIRDAVVATFFDIYEDGILDIVVLSKGYTKTDFAIHTLKNNFEADAYFVKVIVLSGLCS
NDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSVAGQLSQSAHLALQLPYNVLGLGRSA
NFLDHLYVGIPRPSGEKTIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLL
TAVALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM
Download sequence
Identical sequences G3SZ27
ENSLAFP00000005794 ENSLAFP00000005794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]