SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006053 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006053
Domain Number 1 Region: 39-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.22e-22
Family Ubiquitin-related 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006053   Gene: ENSLAFG00000007198   Transcript: ENSLAFT00000007198
Sequence length 423
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_43:1072408:1081986:-1 gene:ENSLAFG00000007198 transcript:ENSLAFT00000007198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPSSLGPGGVRRRVPGFSERSGAHSAADMEPDAQPELEPLTILVKSPNQRHRDLELSCER
SWTVGHLKAHLSRVYPERPDKRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNM
KTPSKTPETSAKVAESTEQPTGLNQGQYPGNSSSDGLRQREALRNLSPSGWENMSRPEAA
QQTFQGLGPGFTGYTTYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVT
APAPAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRDWLDWT
YSAATFSVFLSILYFYSSLSRFLMVMGATIVMYLHHVGWFPFRQRPVENFPDDGPPFEAV
NQDPNNNLQEGGSDPETEDPNHLPPDRDVLEEQTSPSFMSTAWLVFKTFFASLLPEGPPA
IAN
Download sequence
Identical sequences G3SZK2
ENSLAFP00000006053 ENSLAFP00000006053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]