SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006193 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006193
Domain Number 1 Region: 123-384
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-65
Family Nuclear receptor ligand-binding domain 0.00000635
Further Details:      
 
Domain Number 2 Region: 55-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-30
Family Nuclear receptor 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006193   Gene: ENSLAFG00000007367   Transcript: ENSLAFT00000007366
Sequence length 397
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:24702574:24711387:1 gene:ENSLAFG00000007367 transcript:ENSLAFT00000007366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVAGGWGGPGGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVC
GDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRV
GMRKEAVQRGRIPHSLPGAGPASSGSPPGSALAAAGSDLFPGQPVSELIAQLLRAEPYPA
AGRFGGAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLN
AAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLK
AIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPAQPQRFGRLLLRLPALRAVPAS
LISQLFFMRLVGKTPIETLIRDMLLSGSTFSWAYGSG
Download sequence
Identical sequences G3SZV3
ENSLAFP00000006193 ENSLAFP00000006193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]