SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006377 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006377
Domain Number 1 Region: 173-369
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.98e-57
Family Prokaryotic proteases 0.000000615
Further Details:      
 
Domain Number 2 Region: 384-480
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-22
Family HtrA-like serine proteases 0.0031
Further Details:      
 
Domain Number 3 Region: 39-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000377
Family Growth factor receptor domain 0.00083
Further Details:      
 
Domain Number 4 Region: 113-158
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000457
Family Ovomucoid domain III-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006377   Gene: ENSLAFG00000007595   Transcript: ENSLAFT00000007593
Sequence length 483
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_72:252003:309864:1 gene:ENSLAFG00000007595 transcript:ENSLAFT00000007593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPRLPLCNLLFRVLAVCARAQLPRFGRSAPVPAGPATGCPARCESARCAPPPVYCEAGR
VRDACGCCEVCGAAEGEGCGPQEGPCGEGLQCVVPFGVPVSATVRRRAQAGLCVCASSDP
VCGSDGSTYANLCQLRAASHRAERQRQPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVE
KIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGAT
YEAKIKDVDEKADIALIKIDYQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIV
STTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPS
DKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEV
IPDTPAEVGGLQENDVIISINGQSVVSANDVSDVIKKESTLNMVVRRGNEDIMITVIPEE
IDP
Download sequence
Identical sequences G3T0A5
ENSLAFP00000006377 ENSLAFP00000006377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]