SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006546 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006546
Domain Number 1 Region: 394-616
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-55
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 93-209
Classification Level Classification E-value
Superfamily BRCT domain 8.69e-20
Family DNA ligase 0.032
Further Details:      
 
Domain Number 3 Region: 195-313
Classification Level Classification E-value
Superfamily BRCT domain 1.45e-18
Family DNA topoisomerase II binding protein 1, TopBP1 0.047
Further Details:      
 
Domain Number 4 Region: 607-752
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000916
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006546   Gene: ENSLAFG00000007798   Transcript: ENSLAFT00000007800
Sequence length 873
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_42:7158412:7219372:-1 gene:ENSLAFG00000007798 transcript:ENSLAFT00000007800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEEMPQIETRVILVQEAGKHEELTKAIKTVKIMEVPVIKIKESCPGKSDEKLIKSIINM
EIKVPFVKMESVEEFEGLDSPEFENVFIVMDFQNPVFNHLYKADCRIIGPPVVLNCAQKG
EPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANY
THGEKFRVAVSLGTPIMKAEWIYKAWERRNEQDFCAAADNFKNEFKVPPFQDCILSFLGF
SDEEKTNMEEMTEMQGGNHLPVGDERCTHLIVEENIVKELPFEPSEKLYVVKQEWFWGSI
QMDARAGETMYLYEKANTPELKKSVSLLSLNTPNSNRKRRRLKETLAQLSRETDMSPFPP
RKRPSAEHSLSIGSLLDISNTPESSINYGETPKSCTKSSKNSTPVPPKQSARWQVAKELY
QTESNYVNILATIIQLFQVPLEEEGQRGGPILVPEEIKTIFGSIPDIFDVHSKIKDDLED
LIINWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMRKETIIKCEKQKPRFHAFLKINQAK
PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTTDENPDKNTLEKAIGSLKEVMTHINED
KRKTEAQKQIFDVFYEVDGCPANLLSSHRSLVQRVETVSLGEHPCDRGEQVTLFLFNDCL
EIARKRHKVIGTFRSPHSHTRPPPPLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPP
TEQANVLLSFQMTSEELPKESWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDS
TLSKASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHSSVEGRSPSSNDKHVVSRLTST
SSLAGIPSPSLISLPSFFERRSHTLSRSTTHLI
Download sequence
Identical sequences G3T0N3
ENSLAFP00000026271 ENSLAFP00000006546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]