SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006565 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006565
Domain Number 1 Region: 75-290
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-59
Family DBL homology domain (DH-domain) 0.0000211
Further Details:      
 
Domain Number 2 Region: 275-399
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-33
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006565   Gene: ENSLAFG00000007819   Transcript: ENSLAFT00000007822
Sequence length 1212
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_9:40300764:40316833:1 gene:ENSLAFG00000007819 transcript:ENSLAFT00000007822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSASLRQGGSQERPVSLTSTTSSSGSSRDSRGVMEEPNGTEASAENGAGSPRSRQAPN
SNNNSSSWLNRKVPLSPFNSRATAGHKLSYLGRVVREIVETERMYVQDLRSIVEDYLLKI
IDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIYTQY
CNNYPNSVAALTECMRDKQQAKFFRDRQELLQHSLPLGSYLLKPVQRILKYHLLLQEIAK
HFDEERDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTIYGEL
VLEGTFRVHRVRNERTFFLFDKALLITKKRGDHFVYKGHIPCSSLMLIESTRDSLCFTVT
HYKHSKQQYSIQAKTVEEKRTWTHHIKRLILENHHATIPQKAKEAILEMDSYYPNRYRYS
PERLKKAWSSQDEVSTHVHQGRRQSEPTRHLLRQLNEKARAGGMKGKGRSESEDPKGCRR
PSSQSPTNAEKRMSFESVSSLPEVELDPEPEAEREVFAAVEGPSTEEMPSDTESPEVLET
QFDAHQELLEMDHVGDMVDFVVAESSEDLKALSSEEEDDMGAIQEPESLLPPSVLDQASV
IAERFVSSFSRQSSVALEDGKSSGFTTPQLVSRSSSMLSLEGSEKGPAQHGSITDSLTSQ
LPSEVDTSLGVAAESSPSINGTQPPSPGCPAEPDRSSCKKKESLLSTRDRLLLDKIKSYY
ENAEHHDAGFSIRRRESLSYIPKGLVRNSVSRFNNLPRPDPEPVAPLGHKRQAGSRPASW
ALFDLPGPGQDPAPLTDAEFRPSSEIVKMWEGMESSAGSPQKGPGQGQANGFDLHEPLFI
LEEHELGAITEESTTASPESASPTERPSSAHLARELKELVKELSSSGQGELVAPLHPRIV
QLSHVMDSHMSERVKNKVYQLARQYSLRIKGNKSTMARPPLQWEKTVPERNGKSSTIPHL
QEGAGEPLGDKGKRKPLLSFLSYEQMMAQEHSPPKPYSARETSPRRLSFSPSAASPRTTS
PGIRPSGRSPLSPLDTETFNWPDVRELRSKYASHSEALPAESSRPRVVPVNRSHSVPENM
VEPPLRGRVSRCWSLNTKRGRGDEAAAQPQPPGSPLRDGLGGGEALHVTADLILENNLRV
IVMEKGPQPEGLEEGGGQGLSLLAAGLGQGQNLQESAEYLPKEEGPRDPADSSQQGRVRN
LREKFQALNSIG
Download sequence
Identical sequences G3T0P8
ENSLAFP00000006565 XP_003408758.1.64505 ENSLAFP00000006565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]