SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006581 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006581
Domain Number 1 Region: 1011-1350
Classification Level Classification E-value
Superfamily NHL repeat 4.18e-23
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1249-1285,1322-1497
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000133
Family YVTN repeat 0.071
Further Details:      
 
Domain Number 3 Region: 708-779
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000049
Family Pre-dockerin domain 0.069
Further Details:      
 
Domain Number 4 Region: 416-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000349
Family EGF-type module 0.054
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000006581
Domain Number - Region: 547-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 449-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.075
Further Details:      
 
Domain Number - Region: 517-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000614
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 583-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00133
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 382-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 353-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0977
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006581   Gene: ENSLAFG00000007840   Transcript: ENSLAFT00000007838
Sequence length 2552
Comment pep:novel supercontig:loxAfr3:scaffold_62:1541488:1795363:-1 gene:ENSLAFG00000007840 transcript:ENSLAFT00000007838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPPAGGAQEPAHAQDN
WLLNSNIPLETSHRHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFARPAFN
LKKPSKYCNWKCAALSAIVISATLVILLAYFVAMHLFGLNWHLQPMEGQMYEITEDTASS
WPVPTDVSLYPSGGTGLEIPDRKGKGATEEDSFIDSGEIDVGRRASQKIPPGTFWRSQVF
IDHPVHLKFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEARSLEGPPRQS
RGVVPPTSHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCI
SGTCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSN
HGTCIMGTCICNPGYKGESCEEVDCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCL
DQCSGHGTFLPDTGLCSCDPSWTGHDCSIAEICAADCGGHGVCVGGTCRCEDGWMGTACD
QRACHPRCAEHGTCRDGKCECSPGWNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLNG
WHCVCQLGWRGAGCDTSMETACGDSKDNDGDGLVDCMDPDCCLQPLCHVNPLCLGSPDPL
DIIQETQAPVSQQNLHSFYDRIKFLVGRDSTHVIPGENPFDGGHACVIRGQVMTSDGTPL
VGVNISFVNNPLFGYTISRQDGSFDLVTNGGISIILRFERAPFITQEHTLWLPWDRFFVM
ETIIMRHEENEIPSCDLSNFARPNPVVSPSPLTSFASSCAEKGPIVPEIQALQEEITISG
CKMRLSYLSSRTPGYKSVLRISLTHPTIPFNLMKVHLMVAVEGRLFRNWAPYYFNIFNNI
QSKKKDIKAWPLLLLPTVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDKHHA
LNIQSGILHKGNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCG
SDGSLYVGDFNYIRRIFPSGNVTNILELRNKDFRHSHSPAHKYYLTTDPMSGAVFLSDTN
SRRVFKIKSTVVVKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKF
GLIYFVDGTMIRRIDQNGIISTLLGSNDLTSARPLSCDSVMDISQVRLEWPTDLAINPMD
NSLYVLDNNVVLQISENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHN
GVLYIAETDEKKINRIRQVTTSGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNT
PSSLAVCADGELYVADLGNIRIRFIRKNKPFLNTQNMYELSSPIDQELYLFDTSGKHLYT
QSLPTGDYLYNFTYTGDGDVTLITDNNGNMVNIRRDSTGMPLWLVVPDGQVYWVTMGTNS
ALKSVTTQGHELAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRS
DTDSSVHVQVETSNKDDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEV
ALQTEPHLLAGTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNL
LSLDFDRVTRTEKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSPGGHIAGIQR
GIMSERMEYDQAGRITSRIFADGKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDRLSSVTM
PNVARQTLETIRSVGYYRHIYQPPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYGKLS
KLAEMLYDTTKVSFTYDETAGMLKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVN
ARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAV
MTHTKHFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDA
DGQLQTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDLRDRITRLGDVQYKVDED
GFLRQRGGDVFEYNSAGLLIKAYNRAGGWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLT
NPTKVTHLYNHSSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAIFSGTGLMIK
QILYTAYGEIYMDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHELWKQ
LSSSNIMPFNLYMFKNNNPISNSQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDMDAME
PSYELMHTQMKTQEWDNSKSILGVQCEVQKQLKAFVTLERFDQLYGSTITSCQQAPETTK
KFASSGSVFGKGVKFALKDGRVTTDIISVANEDGRRVAAILNNAHYLENLHFTIDGVDTH
YFVKPGPSEGDLAILGLSGGRRTLENGVNVTVSQINTVLNGRTRRYTDIQLQYGALCLNT
RYGTTLDEEKARVLELARQRAVRQAWAREQQRLQEGEEGLRAWTEGEKQQVLNTGRVQGY
DGFFVISVEQYPELSDSANNIHFMRQSEMGRR
Download sequence
Identical sequences G3T0R3
ENSLAFP00000006581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]