SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006607 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006607
Domain Number 1 Region: 2735-3007
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.26e-68
Family Protein kinases, catalytic subunit 0.00000304
Further Details:      
 
Domain Number 2 Region: 1898-2094
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000124
Further Details:      
 
Domain Number 3 Region: 1233-1411
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-51
Family DBL homology domain (DH-domain) 0.00000000749
Further Details:      
 
Domain Number 4 Region: 2096-2218
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-33
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 5 Region: 1415-1533
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-32
Family Pleckstrin-homology domain (PH domain) 0.000000558
Further Details:      
 
Domain Number 6 Region: 2624-2720
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 249-386
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1047-1184
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 797-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 471-612
Classification Level Classification E-value
Superfamily Spectrin repeat 2.77e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2489-2554
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000886
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1584-1675
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000194
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 6-156
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000106
Family CRAL/TRIO domain 0.01
Further Details:      
 
Domain Number 14 Region: 617-724
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000996
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 164-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000249
Family Spectrin repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000006607
Domain Number - Region: 391-503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0767
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006607   Gene: ENSLAFG00000007860   Transcript: ENSLAFT00000007868
Sequence length 3038
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_7:16102058:16386836:1 gene:ENSLAFG00000007860 transcript:ENSLAFT00000007868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEV
CKRGFTVIVDMRGSKWDSIKPLLKVLQESFPRCIHVALIIKPDNFWQKQRTNFGSSKFEF
ETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYVSNATHMLSRLEELQD
ILAKKELPQDLEGARNMIEEHSQMKKKVIKAPIEDLDLEGQKLLQRIQSSDSFPKKNSGS
GNVDLQSLVPKVSSMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHN
KGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQI
KQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQD
LEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLD
VIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKS
LHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDF
VRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQT
TLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERK
IKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMN
NLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQH
RKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEK
THQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKT
SEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARR
NADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQ
YVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLL
IQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSVRMEKYRTSLEKALGISSDSNKSSKSL
QLDIIPASTPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYL
WEMTSGVEEIPPGIVNKELVIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADK
FQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKEL
LTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELFLQESFQVWDPKT
LIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWV
GRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGR
RDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRR
GQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSV
SSNDASPPASVASLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHK
HKKSREVRKSVDAGSQKDSDDSAATPQDETIEERGRNEGLSSGTLSKSSSSGMQSCGEEE
GEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLVRPTSSETPSAAELVSAIEELVKS
KMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVE
TERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLE
DPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIK
PVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPKRCNDMMNVGRLQGFDGKIV
AQGKLLLQDTFLVTDQDTGLLPRCKERRVFLFEQIVIFSEPLDKKKGFSMPGFLFKNSIK
VSCLCLEENVENDPCKFALTSRTGDVVETFILHSSSPSVRQTWIHEINQILENQRNFLNA
LTSPIEYQRNHSGGSGGSSSGGGGGGGGPSSSGSSNHSAGPGSCGGIPSSSRGRPSRIPQ
PVRHHSPVLVSSAASSQAEADKMSGTSTHGPSLPPPSSGLTPEATPSQPSRPPLSGECEG
PEKEAEPIPKMKVMESPRKSANGNTKEARGHAEDGRPRASLGALPLAKPRPGAISPLNSP
LSTTFPSPFGKEPFPPSSPLQKGGSFWSAIPTSPASRPGSFTLPGDSDSLQRQAQRHTAP
SKDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQ
ILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSTVVLENPDGTLKKSTSWHTALRLR
KKSEKKDKDGKREGKLENGYGKSRAGLSNKVSVKLLNPNYIYDVPPEFVIPLSEVTCETG
ETVVLRCRVCGRPKASITWKGPEHNTLNNDGHYSISYSDLGEAALKIVGATTEDDGLYTC
IAVNDMGAASSSASLRVLGPGSDGIMVTWKDNFDAFYSEVAELGRGRFSVVKKCDQKGTK
RAVATKFVNKKLMKRDQVTHELGILQNLQHPLLVGLLDTFETPTSYVLVLEMADQGRLLD
CVVRWGNLTEGKIRMYLGEVLEAVRYLHNCRIAHLDLKPENILVDQSSAKPTIKLADFGD
AVQLNTTYYIHPLLGNPEFSAPEIILGNPVSLTADTWSIGVLTYVLLSGVSPFLDDSVEE
TCLNICRLDFSFPDDYFKGVSQKAKDFVCFLLREDPATRPSAALSLQEHWLQAGHSKSAA
TLDTSRLTSFIERRKHQNDVGPIRSIKNFLQSRLLPRV
Download sequence
Identical sequences G3T0T2
ENSLAFP00000006607 ENSLAFP00000024177 XP_010586376.1.64505 XP_010586377.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]