SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006685 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006685
Domain Number 1 Region: 784-959
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.81e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000393
Family SAM (sterile alpha motif) domain 0.0034
Further Details:      
 
Domain Number 3 Region: 531-654
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000712
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 4 Region: 1045-1196
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000438
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Domain Number 5 Region: 280-335
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000056
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 
Domain Number 6 Region: 669-775
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000184
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 7 Region: 1002-1065
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000207
Family Ras-binding domain, RBD 0.075
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000006685
Domain Number - Region: 423-474
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00149
Family Pyk2-associated protein beta ARF-GAP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006685   Gene: ENSLAFG00000007967   Transcript: ENSLAFT00000007971
Sequence length 1418
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:59412843:59441423:-1 gene:ENSLAFG00000007967 transcript:ENSLAFT00000007971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDIAVWLAKVHLEQYADTFRQHGLTTAGAARGLGQEELRQLGISATGHRKRILR
LLQASAAEGFPDPQSDSAMEPSSSPDPQAQTSKPVPKPRTVFGGLSGPATTQRPGPSPAL
RGPEVSRSPESSPRSPPLPTSSEQTSALNTMEMTPNAIYFGLDLRGGSQATQDITPESSQ
KAAPTPALRPATGTVHIMDPGCLYYGVQPVGVSGSPDRREGRGVCQDRAEHRQDLEAREN
AGYASLELPGDSTFLMPTLDTEETSDDLISPYASFSSTADPPMPLLSGWLDKLSPQGNYV
FQRRFVQFNGRSLMYFGSDKVGPLPQGVIPLTAIEMTAATGHKFRSPPLYPDKINHRTVG
LLVISKGARAGSWIQSCRGRGVKEGEKWGRMEEGASKKRPRPSLAQGCGESGIPGDLPLP
LIILQLFIVLGNNRANRFWAAALPPGERLHPDASPGPRGEFISRKYRSGLFRKPHPQYTD
HSQFLQALCAAVAGPNLLKNMAQLLCVEASEGEEEPWTPSALDGNLPGLLPPDPSPGVYN
EVVVPATYSSFLYCGSISNKAGPPPPRKGRDAPQRLWCVLGAALEMFVSESSSEPLSLIQ
PQDVVCLGVSPPPTDTGDLDRFPFSFELILTGGRIQHFGTDGADSLEAWTSALGKWFSPL
SCHQLLGPGLLRLGRLWLRSPSHTALAPGLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMV
HLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGESRLDFSAWNAAIGGAAGGGGTGL
QEQQMSRCDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPG
EHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKEVIGCLPRVNRR
TLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGYVSVFD
IDSDQIAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSPTLTAEELTN
QVLEMRGTAAGTDLWMTFEILEHGELERPLHPKERVLEQALQWCQLPEPCSASLLLRKVS
LAHGGCLFTGTRRESPRMGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLKEKKNLSSVP
RFAPVLSGSICHLHIDISHLPKMPFFLTYVLVTSFVLVYLSCTDEDEMWDWTTSILKAQH
DDQQPVVLRRRSSSDLAHQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPM
KSSQGSVDEQEELEEPVYEEPVYEEVGAFPDLTEETSTSSTIREWTAKPENPLPSQRFFD
QLLLSKAGTLGWEERPPEPPPGPPSKSSPQAHGSLEEQLLQELSSFILRKGETTTGLGSP
SQPSSPQPPSPTGLPTQTSSFPTEPPCTSSLPSSQPLT
Download sequence
Identical sequences G3T0Y4
ENSLAFP00000006685 ENSLAFP00000006685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]