SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006704 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006704
Domain Number 1 Region: 1194-1532
Classification Level Classification E-value
Superfamily NHL repeat 1.12e-23
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1424-1716
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000916
Family SGL-like 0.048
Further Details:      
 
Domain Number 3 Region: 631-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000006704
Domain Number - Region: 889-959
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00011
Family Carboxypeptidase regulatory domain 0.043
Further Details:      
 
Domain Number - Region: 600-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000479
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 697-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000479
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 729-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00122
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 565-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0016
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 762-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00264
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 535-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 2098-2196,2288-2348
Classification Level Classification E-value
Superfamily NHL repeat 0.0497
Family NHL repeat 0.014
Further Details:      
 
Domain Number - Region: 1647-1739,1800-1893
Classification Level Classification E-value
Superfamily NHL repeat 0.068
Family NHL repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006704   Gene: ENSLAFG00000007987   Transcript: ENSLAFT00000007993
Sequence length 2732
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_32:5609660:6226771:1 gene:ENSLAFG00000007987 transcript:ENSLAFT00000007993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
SRKRKEVEKSTQEMEFCETPHALCSGYQTDMHSVSRPGYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDM
QSSPHNQFTFRPLPPPPPPPHACTCARKPPPTADSLQRRSMTTRSQPSPAAPAPPTSTQD
SVHLHNSWVMNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGQLYENG
VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQ
HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVPEEQCIDPT
CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSSHGICVKGECHCSTGWGGVNCETPLP
VCQEQCSGHGTFLLDTGVCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPT
CEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
GWHCVCQVGWSGAGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYVSPLCQGSPDP
LDLIQQSQPLFSQHTSRLFYDRIKFLIGKDSTHVIPPEISFDSRRACVIRGQVVAVDGTP
LVGVNVSFLHHSDYGFTISRQDGSFDLVAVGGISVVLIFDRSPFLSEKRTLWLPWNQFIV
VEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIP
SSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAVNLIYT
FAWNKTDIYGQKVWGLAEALVSVGYEYEMCPDFILWEKRTVILQGFEMDASNLGGWSLNK
HHILNPQSGIIHKGNGENMFISQQPSVISTIMGNGHQRSVACTNCNGPARNNKLFAPVAL
ASGPDGSVYVGDFNFVRRIFPSGNSISILELRNRDTRHSTSPAHKYYLAMDPVSESLYLS
DTNTRKVYKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITV
DRHGFIYFVDGTMIRKIDENAMITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVN
PMDNSLYVLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISV
SHSGLLFIAETDERKVNRIQQVTTNGEISIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAK
MKAPSSLAVLPDGTLYVADLGNVRIRTISRNQPHLNDVNLYEIASPADQELYQFTVNGTH
LHTLNLITRDYVYNFTYNAEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTIS
SNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSS
FHSDLEKLTKVELDTSNRENVLMSTNLTAMSTIYILKQENTQSTYRVSPDGSLRVTFASG
MEISLSSEPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNRGNISAFERRLRAHN
RNLLSIDFDHITRTGKIYDDHRKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTF
IQRGTWNEKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSDCLLS
VTMPSMVRHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYT
KQARLSEILYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEG
LVNARFDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITT
TVMKHTKIFSANGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEY
DADGQLQTVSVNDRTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMD
EDGFLRQRGNDVFEYNSNGLLQKAYNKVSGWTVQYYYDGLGRRVASKSSLGQHLQFFYAD
LANPIRVTHLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQV
IKEILYTPYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVLLGQRDYDVVAGRWTTPNHHVW
KQLNLLPKPFNLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPELENL
ELTYELLQLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPQYSDGRCLEGGKQP
RFAAVPSVFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTH
YFIKLGSLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNI
RYGTTVEEEKNHVLEIARLRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGY
DGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences G3T0Z9
XP_003414806.1.64505 ENSLAFP00000006704 ENSLAFP00000006704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]