SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006998 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006998
Domain Number 1 Region: 136-414
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.47e-78
Family Nuclear receptor ligand-binding domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 86-167
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-24
Family Nuclear receptor 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006998   Gene: ENSLAFG00000008347   Transcript: ENSLAFT00000008345
Sequence length 452
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:39647965:39663563:-1 gene:ENSLAFG00000008347 transcript:ENSLAFT00000008345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNKERLFTTSALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRYKPCFVCDKSSGYHYGVSSCELQGFFRRSIQKNMV
YTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELS
PQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVE
FAKRVPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAG
FGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRL
YTRRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIQEMLENPEMFE
DDSSQPGPHPKASSEDEVPRGQGKGGQSPQPD
Download sequence
Identical sequences G3T1M9
ENSLAFP00000006998 ENSLAFP00000006998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]