SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007196 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007196
Domain Number 1 Region: 731-911
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 886-1007
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.59e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 26-56,149-278
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-29
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000007196
Domain Number - Region: 273-334
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0667
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007196   Gene: ENSLAFG00000008569   Transcript: ENSLAFT00000008569
Sequence length 1137
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_11:31760650:31847081:1 gene:ENSLAFG00000008569 transcript:ENSLAFT00000008569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVPDVISSIRQLSKAAMKEGAKPNKDNEDAFYNSQKFEVLYCGKVIVTHKKAPSSLIDDC
IEKFSLHEQQRLKIQGEQRSTEPSDDLVVSEAEDPSPPGDSLLEEIDGIPSTHSGLPAVA
SQPVLSSSRVSFPERILEDSGFDEQQEFRSRCSSVTGVMQRKVHENSQKAQPRRRHASAP
SHVQPSDSEKNRTMLFQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICR
ESSEPGLSQYICYVFQCASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHK
LCERIEGLYPPRAKLVIQRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCE
AKQRTHAHTGEGPSTVSNSAIPENATSGGRFKLDILKNKAKRSLTSSLENIFSRGANRMR
GRLGSMDSFERSNSLASEKDYSPGDSPPGTPPASPLSSAWHTFPEEDSDSPQFRRRAHTF
SHPPSSTKRKLNLQDGRAHGVRSPLLRQSSSEQCSILPSAGRIHKESNSSSSLPSLHTSL
SVPSFTAPSFLKSFYQNSGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSAGGT
PVTPRRISWRQRIFLRVASPMNKSPSAMQQQEDGLDRNELLPLSPLAPTMEEEPLVIFLS
GDNDPEKDEERNKSEELRSLWRKAIHQQILLLRMEKENQKLEEASRDELQSRKVKLDYEE
VGVCQKEALITWDKKLLNCRAKIKCDMEDIHTSLKEGVPKSRRGEIWQFLALQYRLRHRL
PNKQQPPDTSYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGAGQLSLFNLLKAYSLL
DKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRL
LHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVAL
SLLSSQETLIMECENFENIVEFLKNTLPDMNMSEMEKIITQVFEMDISKQLHAYEVEYHV
LQDELQESSYACEDNEPVEKLERANSQLKRQNMDLLEKLQVAHAKIQTLESNLENLLTRE
IKMKSLIRTLEQEKMAYQKTVEQIRKLLPADALASCELLLRDLNCNPNNKAKTGNKP
Download sequence
Identical sequences G3T230
ENSLAFP00000021411 ENSLAFP00000007196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]