SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007223 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007223
Domain Number 1 Region: 175-559
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-163
Family Myotubularin-like phosphatases 0.00000000000055
Further Details:      
 
Domain Number 2 Region: 49-172
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-45
Family GRAM domain 0.000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007223   Gene: ENSLAFG00000008600   Transcript: ENSLAFT00000008600
Sequence length 617
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_35:6189753:6230065:-1 gene:ENSLAFG00000008600 transcript:ENSLAFT00000008600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASTSHSENSVHTKSASVISSDSISTSADNFSPDLRVLRESNKLAEMEEPPLLPGENIKD
MAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVISRVEKIGGASSRGE
NSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVFPENGW
KVYDPLLEYRRQGIPNESWRLTKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGR
IPVLSWIHPESQATVTRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVN
AVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLEST
HWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFE
VLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLV
TILDHLYSCLFGTFLCNSEQQRGKENLLKRTVSLWSYINSQLEDFTNPLYGSYSNHVLYP
VASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSSSSS
ERASSPAQCVAPVQTVV
Download sequence
Identical sequences G3T254
ENSLAFP00000007223 ENSLAFP00000007223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]