SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007351 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007351
Domain Number 1 Region: 213-453
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.27e-67
Family Nuclear receptor ligand-binding domain 0.000000000573
Further Details:      
 
Domain Number 2 Region: 85-172
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.99e-26
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007351   Gene: ENSLAFG00000008751   Transcript: ENSLAFT00000008750
Sequence length 454
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_4:10216000:10223393:1 gene:ENSLAFG00000008751 transcript:ENSLAFT00000008750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPTTSSLDSPLPGNGPPQPGAPSSSPAIKEEGPEPWPGGPDPDVPGTDGAGSACSTAL
VIPDPMEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
GRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIQKQQQQQSPV
GSGGGSSLSSGPGASPGEPEGGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQ
PKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKA
STIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLD
DAEYALLIAINIFSADRPNVQEPSRVEALQQPYVDALLSYTRIKRPQDQLRFPRMLMKLV
SLRTLSSVHSEQVFLRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences G3T2F8
ENSLAFP00000026150 ENSLAFP00000007351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]