SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007399 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007399
Domain Number 1 Region: 152-166,301-541
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-66
Family Nuclear receptor ligand-binding domain 0.00000000261
Further Details:      
 
Domain Number 2 Region: 84-167
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007399   Gene: ENSLAFG00000008809   Transcript: ENSLAFT00000008808
Sequence length 543
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_13:3688873:3846350:1 gene:ENSLAFG00000008809 transcript:ENSLAFT00000008808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNSDTRDLRESLKYGLTPTGAGLPDGHGPPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESLMGYSYMDGYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDSDVKNLENFQLVEGVQEQVN
AALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHA
KRA
Download sequence
Identical sequences G3T2J8
ENSLAFP00000007399 ENSLAFP00000007399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]