SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007518 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007518
Domain Number 1 Region: 1294-1461
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-30
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1023-1135
Classification Level Classification E-value
Superfamily CalX-like 1.7e-21
Family CalX-beta domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007518   Gene: ENSLAFG00000008954   Transcript: ENSLAFT00000008958
Sequence length 1462
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:84091869:84184107:1 gene:ENSLAFG00000008954 transcript:ENSLAFT00000008958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALQHAVNYMKVAYMPPMQDIGPHPQHVQFTFSISNQHGGILHGICFNITILPVDNQVPE
VFTNPLRVAEGGQCVISTEHILVSDADTKLDNIYLSLQRPPLHGRVELNGLPLNTGSTFS
WEDLHALKIRYQHDGSEVLQDDILLEVTDGTNSAEFVLHIKVFPVNDEPPVLKADLIPMM
HCSEGEEVVITSEYIFATDVDSDDSRLVFMIARKPQHGVVRKAGIITDQFSQGDVISRAV
TYKHTGGEIGLMPCFDTITLVVSDGQAGPFVNGCCYSGAHPSVPLHESFPVYDLNITVHP
VDNQPPSIAIGTMFVVDEGLSASVTINHLSATDPDTAADDLEFVLVSSPQFGYIENTLPS
AGFEKSNMGKSIASFQWKDMKALHVNYVQSKHLRIEPTADQFMVYVTDGKRRSLEIPFHV
IINPTNDEAPDFIVQNITVREGQMRELGSSVINAADLDIPKDSLLFTITHEPRHGLLING
VFSEGLPQYKQPANPDQKHHLVHNFSMELLKTGMRLLYVHDDSESLADDFTIQLSDGKYK
LVKTISVEVTPVNDQKPVLTKKAEIVMNMGETRIISNAVLSATDEDSPREKIYYLFERLP
QNGQLQLKIGRDWVPLYPGMKCTQEEVDLNMLRYTHTGAVDSQNKDSFTFYLWDGDNRSP
AFECHITIKDIGKGKFIILINKSILYQKDPFGHLSIKVIVYPNRTTKFLFCLYVITSPPQ
YGQLSWSRPLQASDEWHIAVQTVCYILQAKITKVPSWSKVKFLFIVSNGLRTKHGVFEVT
LETVDKALPVVTMNKGLRLIKGATGLLTPDLLQLTDPDTPLEKLTFLLAQLPQHGQLFLR
GTALLHPNFTQQDVDSKNVAYRHSGGDSQIDQFTFTATDRTNQGFVVDGRVWEEPVSFTI
QVDQLDKMAPHITYLRSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKISQGPQH
GHLENTTTVGEFIHEKFSQKDLNSKTILYIINPSREVNSDVMEFQIMDPTGNSAPPQILE
LKWSHIEWSQTDYEVCEDVGVFPLEITRTGFLMDSAFVSVKVNPVSATVGKDFTVTPSKL
IQFDPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHR
SYHSNQNKHKAREKGIWHPLHRGSSSPTTSGSFHLERKPFVSSMRLAVTRGDSPRGFDST
DLSRMRLRPRGNGRTIHPSSVYRNGTDIIYNYHGTVSLKLEDDSSSTHKRKAKVSVISCP
QKTIKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFYFEESLQKLYQCNGTA
WKAWSPQTKEVEDKPCPAGWHHHSGYCHSLITEQKRTWTAAAQACREEHLGSLVTVLTRQ
HMRWLWDISGRRPFWIGLNDQVHAGYWEWIGGEPVTFTNWRKVTHQHSKPGKNCVLVHRQ
GKWQTKDCRQGKPHSYICSRKL
Download sequence
Identical sequences G3T2U4
ENSLAFP00000007518 ENSLAFP00000007518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]