SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007709 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007709
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 4.28e-80
Family Integrin A (or I) domain 0.000000283
Further Details:      
 
Domain Number 2 Region: 367-481
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-23
Family Integrin domains 0.0042
Further Details:      
 
Domain Number 3 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000194
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 644-711
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000602
Family Integrin beta tail domain 0.009
Further Details:      
 
Domain Number 5 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Integrin beta EGF-like domains 0.0058
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000007709
Domain Number - Region: 534-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0215
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007709   Gene: ENSLAFG00000009194   Transcript: ENSLAFT00000009196
Sequence length 791
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:39632046:39640548:-1 gene:ENSLAFG00000009194 transcript:ENSLAFT00000009196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSMVIWSLLALSRAERELDTKIPSLGEATEWGDPDLSLLGSCQPAPSCQQCILSHPS
CAWCKQLNFTASGEAEERRCAGREELLARGCPLEELEEPRSRQEVLQDYPFSQGARGEGT
VQLAPQRVRVMLRPGEPQRLQVRFLRAEGYPVDLYYLMDLSYSMKDDLEQVRQLGHDLLL
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLEPCQPPFSFHHVLSLTTEAK
VFEQEVGLQNVSGNLDSPEGGFDAILQAAVCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFRPSDGRCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYQELS
KLIPKSTVGELSENSSNVLQLIMDAYNSLSSTVTLQHVSPLPGVHISYESQCGGPKKREG
ETGDRGQCNHVRINQTVNFWVTLQAAHCFTEPQLLRFRALGFSEELTVELHTLCDCNCSD
TQPQAAHCSDGQGHLQCGVCSCAPGRRGRLCECSEAELSSPDLESGCRAPNGTGPLCSGK
GRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
SVDSCVSSEGGLCSGHGHCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFGTG
PLTTNCSMACAHANVTLALAPILDDGWCKERTLDNQLFFFLVEEAGGRVVLRVRPQEKGA
DHTQAIVLGCVGGIVAVGLVLVLAYRISVEIYDRREYSRFEKEQQQLNWNQDNNPLYKSA
ITTTINPRFQG
Download sequence
Identical sequences G3T3B0
ENSLAFP00000007709 ENSLAFP00000007709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]