SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007766 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007766
Domain Number 1 Region: 206-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-70
Family Nuclear receptor ligand-binding domain 0.000000000601
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007766   Gene: ENSLAFG00000009267   Transcript: ENSLAFT00000009267
Sequence length 447
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_21:2256234:2262842:-1 gene:ENSLAFG00000009267 transcript:ENSLAFT00000009267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWLESPVPDVSPDSVVELWESDVQDASSQMLGGSNCILREETRTPQPTRGTSGVGLEA
AEPAARLPRAKPSPESTELRPPKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAQTTSVSPRASSPTQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences G3T3E9
ENSLAFP00000007766 XP_003412295.1.64505 ENSLAFP00000007766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]