SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007777 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007777
Domain Number 1 Region: 302-384
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000353
Family Integrin alpha N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007777   Gene: ENSLAFG00000009281   Transcript: ENSLAFT00000009280
Sequence length 436
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_4:6818938:6828103:-1 gene:ENSLAFG00000009281 transcript:ENSLAFT00000009280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEATVAAGPCPLREDSFTRFSSQSNVYGLAGGASGRGELLAATLKGKVLGFRYQDLRQK
IRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEP
GSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVADQLDTVFLLSGNNPAIHLYKENEGLHQ
FEEQPVENLFPELTNLTSSVLWLDVHNLPGTSRRLTALGCQSGYVRVAHVDQRSREILQT
WTILQDGPISRVIVFSLSAPEETKERPQREEYSVLVASMLEPAVVYRDLLHRGLEDQLLL
PGSDQFDSILCGLVTDVDLDGRLEVLVATYGQELLCYKYWGPESGLPEAEHGFRLLWQRS
FSSPLLAMAHVDLTGDGLRELVVVSLKGVHILQHSLIQASQLALTRLRHQVEQRRRQHQQ
ELGGRVLPRRIEGGGF
Download sequence
Identical sequences G3T3F7
ENSLAFP00000007777 ENSLAFP00000007777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]