SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007822 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007822
Domain Number 1 Region: 19-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-77
Family Pancreatic carboxypeptidases 0.000000634
Further Details:      
 
Domain Number 2 Region: 341-416
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.47e-19
Family Carboxypeptidase regulatory domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007822   Gene: ENSLAFG00000009332   Transcript: ENSLAFT00000009333
Sequence length 418
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_10:18197854:18410058:1 gene:ENSLAFG00000009332 transcript:ENSLAFT00000009333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLFSVFLHLLLLFKLAAPVTFRHHRYDDLMRMLYKVHNECPYITRVYSIGRSVKGRHL
YVLEFSDYPGIHEPLEPEVKYVGNMHGDEVLGRELLLQLSEFLCEEFRNGNPRIIRLIEG
TRIHILPSMNPDGYEVAADQGPDNSEYLVGRNNANGVDLNRNFPDLNTYFYYNEKYGGPN
HHLPLPDNWKSQVEPETRAVIQWIRSINFILSANLHGGAVVANYPYDKSLEHRVRGFRRT
ANTPTPDDKLFQKLAKVYSYAHGWMYQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFDITLELSCNKFPHQEELHREWLGNREALIQFLEEVHQGIKGMVFDENCNNVVGAVIS
ISGINHDVTSGDHGDYFRLLLPGTYTVTASAPGFDPETVSVTVGPAEPKQVNFHLKHS
Download sequence
Identical sequences G3T3I8
ENSLAFP00000007822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]