SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007964 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007964
Domain Number 1 Region: 68-402
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-80
Family Protein kinases, catalytic subunit 0.00000268
Further Details:      
 
Domain Number 2 Region: 880-931
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000598
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0065
Further Details:      
 
Domain Number 3 Region: 947-1080
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000114
Family Pleckstrin-homology domain (PH domain) 0.054
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000007964
Domain Number - Region: 637-673
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 0.00165
Family XRCC4, C-terminal oligomerization domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007964   Gene: ENSLAFG00000008882   Transcript: ENSLAFT00000009493
Sequence length 1555
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_71:4644894:4664247:1 gene:ENSLAFG00000008882 transcript:ENSLAFT00000009493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRLRALEWLARGEAGGGPWLDGLLDLLLALHHELSSAPLRRERYVAQFLSWASPFVSK
VKELRLQRDDFEILKVIGRGAFGEVAVVRQRDSGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPSELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNVLLDMNGHIRLADFGSCLRLNNSGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPPD
VPDVPASAQDLIRQLLCRQEERLGRGGLDDFRNHPFFEGVDWERLATSTAPYIPELRGPV
DTSNFDVDDDTLNHPGTLPPPSHGAFSGHHLPFVGFTYTSTSPGPEGGSERLAALERKIM
CLEEEKAELSRKLYEVRLSPSDRQDLEQLRKEVQTLRERLSETLKERDGKAPLSQMDRPP
ADSPGQASDLRQERDQLRQELAEAQRGLRALEQELCRAQQQQEELFQRLQEAQEREVATA
SQTQALSSQLEEAWDARRELEAQVASLSQEVTQLQRQWERSLEKESTSVKTVHTASETNG
TGPPGGGLQEAQLQKEVAALRVQLDQARSQGPSGKEEVLCRLQEENQRLSREQERLAEEL
EQEQQSKQRLEGERRETESNWEAQIADILSWVNDEKVSRGYLQALATKMAEELESLRNVG
TQTLPARPLDHQWKARRLQKMEASARLELQSALEAEIRAKQGLQERLTQVQEAQLRAESR
LQEAEKQNQGLQQELAALQEELQARGPGDTKPLNTLLPFLSFWSSEKDSAKDSGVSGEAS
RSGLEPELRPEGRRSLRMGVRQAESWSWGASDGMSHRPQPGSHVLRPRTFPSPTKCLHCT
SLMLGLGRQGLGCDACSYFCHSMCAPQAPLCPVPPDLLRTALGVHPETGTGTAYEGFLSV
PRPSGVRRGWQRVFAAVSDSRLLLFDAPDPRLSPASGAFLQALDLRDPQFSATPVLASDV
IHAQSRDLPRIFRVTASQLAVPPTTCTVLLLAESEGERERWLQVLGELQRLLQDVRPQPR
PVYTLKEAYDNGLPLLPHTLCAAIIDQERLALGTEEGLFVIHLHTNDIFQVGECRRVQRL
AMSPTVGLLVVLCGRGPSVRLFALAELENTEATGAKITESRGCQALAAGRILQARTPVLC
VAVKRQVLCYQLGPGPGPWQHRIRELQAPAPVQSLGLLGDRLCVGAAGAFTLYPLLNEAA
PLALGAGLVPEELPPSRGGLGEALGAVELSLSELLLLFTTAGVYVDSAGRKSRGHELLWP
AAPTGWGYAAPYLTVFSENSIDVFDVRRAEWVQTMPLKKVRPLNPEGSLFLYGTEKVRLT
YLRNRLAEKDEFDIPDLTDNSRRQLFRTKSKRRFFFRVSEEQRQQQRREMLKDPFVRSKL
ISPPTNFNHLVHVGATDGKPTARGLARVPEEKGRGARSSGPQRPHSFSEASRRPASMDSD
TLAGDVDPMKRKPRTSLSSESVSCPQGSLSPAASLTQVSERPRSLPPAPDSESSP
Download sequence
Identical sequences G3T3U2
ENSLAFP00000019101 ENSLAFP00000007964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]