SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008218 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000008218
Domain Number - Region: 148-220
Classification Level Classification E-value
Superfamily PH domain-like 0.00101
Family TFIIH domain 0.029
Further Details:      
 
Domain Number - Region: 21-79
Classification Level Classification E-value
Superfamily PH domain-like 0.0101
Family GRAM domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008218   Gene: ENSLAFG00000009805   Transcript: ENSLAFT00000009805
Sequence length 341
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_3:57834374:57854351:-1 gene:ENSLAFG00000009805 transcript:ENSLAFT00000009805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLDALWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWH
SLALPRVNLSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNVVPGSPRL
FTSVIAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTF
FITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV
EKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDNHTDAFV
AYFADGNKQQDREPVFSEELGLAIEKLKDGITLQGLWEVMS
Download sequence
Identical sequences G3T4E0
ENSLAFP00000019289 XP_003405852.1.64505 ENSLAFP00000008218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]