SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008427 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008427
Domain Number 1 Region: 85-250
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.09e-38
Family CRAL/TRIO domain 0.0023
Further Details:      
 
Domain Number 2 Region: 318-457
Classification Level Classification E-value
Superfamily PapD-like 4.97e-37
Family MSP-like 0.000000286
Further Details:      
 
Domain Number 3 Region: 39-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000379
Family CRAL/TRIO N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008427   Gene: ENSLAFG00000010054   Transcript: ENSLAFT00000010056
Sequence length 518
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_39:16833260:16877171:-1 gene:ENSLAFG00000010054 transcript:ENSLAFT00000010056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESQAQIKTRLIADTRRRFEAEYLADKSDKYDPRDVERLQQDDNWVESYLLWRHNVVDE
TLKMLDESFQWRKEFAVNDLSESSIPRRLLEIGGIYLHGYDKEGNKLFWIRVKYHVKDSK
TALDKKKLIAFWLERYAKRENGKPITVMFDLSETGINNIDMDFVRFIINCFKVYYPKYLS
KLVIFDMPWIMNAAFKLVKTWLGPEAMSLLKFTSKNEIQEYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTAPVKKSSPTEPN
SKAEENEKVDSKMKAFKKPLSVFKGPLLHISPAEELYFGTAESGEKKTLIVLTNVTKNIV
AFKVRTTAPEKYRVKPSNSSCEPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGSGP
AELAQFWKEVPKNKVMEHRLRCHIIEGSKPTTLTLKDSAFNMSDKTSEDICLQLNRLLES
NRKLQDQVQRCIWFHQLLLSLMMLSLAFVISFFYLLYS
Download sequence
Identical sequences G3T4X1
ENSLAFP00000008427 ENSLAFP00000008427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]